PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G297400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 270aa    MW: 30808.1 Da    PI: 9.503
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G297400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-175096148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg W++ Ed+ lv++v+ +G ++W++Ia+++g  R +kqc++rw+++l
  Aqcoe6G297400.1.p 50 RGQWSAAEDQSLVRLVNTYGAKSWSLIAARLG-SRNGKQCRDRWNNHL 96
                       89******************************.*************97 PP

2Myb_DNA-binding574.3e-18102147148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        r++W+ eEd+ ++da+k+ G++ W+ Ia++++ gRt+  +k+rw+ y+
  Aqcoe6G297400.1.p 102 RQAWSVEEDKAFIDAHKEIGNR-WAEIAKRIP-GRTEIAIKNRWNLYR 147
                        89********************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.26945100IPR017930Myb domain
SMARTSM007173.7E-164998IPR001005SANT/Myb domain
SuperFamilySSF466894.31E-3049143IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-2551103IPR009057Homeodomain-like
PfamPF139216.3E-1853111No hitNo description
CDDcd001673.39E-135396No hitNo description
SMARTSM007171.7E-15101149IPR001005SANT/Myb domain
PROSITE profilePS5129420.372101151IPR017930Myb domain
CDDcd001672.82E-11104146No hitNo description
Gene3DG3DSA:1.10.10.607.5E-19104149IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MVNSQPSQIL ETSNIFVEED TSLLPENNYF AMKSKLLSKM LSKVKPIVTR GQWSAAEDQS  60
LVRLVNTYGA KSWSLIAARL GSRNGKQCRD RWNNHLRPVI KRQAWSVEED KAFIDAHKEI  120
GNRWAEIAKR IPGRTEIAIK NRWNLYRRKL LSNAENQKKG NSNQPKSELL EYISLCARMG  180
MLDGKVKKNP KTATKESFNC NLAIKGKCEE MEESQDVYKP YIPFVVNEDS HGEQLNVARE  240
PNHVLVEDKE LSGLEIPKSG FSQGEWSWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-36461443101B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444519.12e-41PREDICTED: myb-like protein AA
SwissprotQ9S7L21e-41MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0D2NEN82e-41A0A0D2NEN8_G
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.18e-43myb domain protein 98